PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000528658
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 287aa    MW: 32196.7 Da    PI: 7.4162
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000528658genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM104.41.5e-322810154128
            NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                    + kewyf+s+rd+kyatg r+nrat++gyWkatgkd+++l+ +g+lvg++ktLvfy+grapkg+k+dWvmhe+r+
  MDP0000528658  28 GGKEWYFYSQRDRKYATGLRTNRATATGYWKATGKDRPILR-RGSLVGMRKTLVFYQGRAPKGRKSDWVMHEFRV 101
                    679*************************************9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100538.9511125IPR003441NAC domain
SuperFamilySSF1019414.97E-3823126IPR003441NAC domain
PfamPF023651.5E-1424101IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDDDESPPFA FLSPCAGYQE VFESACVGGK EWYFYSQRDR KYATGLRTNR ATATGYWKAT  60
GKDRPILRRG SLVGMRKTLV FYQGRAPKGR KSDWVMHEFR VEGPLGPPKI SSLKEDWALC  120
RVFYKNREIA AKPSMGISCY DDTSTLTLPA LMDSYINFDG QTQSQTQTQT QPQEYEQVPC  180
FSMFSQNQTN PFFTHTDITS SQPNIPTKHS NNNNTTTXGG LPNMTNFLDP FSCDKIVLKT  240
VLSHLTKMES TTYPTLNGSS PSFGEGSSSE NYLSDVGMPN NIWSHY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-302312862171Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.1550.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981230.0KF198123.1 Malus hupehensis NAC domain protein (NAC88) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009336675.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE61e-92NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLS5RUW81e-169S5RUW8_9R
STRINGGLYMA08G18470.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100103241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.13e-85NAC domain containing protein 1